Gene DSC1 Modification Unmodified Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. View specifications, prices, citations, reviews, and more. genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). Store at 4C short term. This antibody reacts with human. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. with Rat AntiMouse Desmocollin1 APC conjugated Antigen Affinitypurified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). 100 μg. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. 200 μg. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Order anti-Desmocollin 1 antibody ABIN6868586. Validated: IHC, IHC-P. 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. The expected protein mass is 100 kDa, but there are 2 reported isoforms. This antibody reacts with human. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … This product is for research use only and is not approved for use in humans or in clinical diagnosis. Concentration: 0.25 mg/ml purified IgG. Desmocollin 1 is a component of intercellular desmosome junctions. Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. View All Primary Antibodies ; Monoclonal Antibodies Validated for IHC and WB. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. hair follicle root sheat, and Hassall bodies. Selected quality suppliers for anti-Desmocollin 1 antibodies. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. This antibody reacts with human, mouse samples. View All Primary Antibodies ; Monoclonal Antibodies Mouse monoclonal Desmocollin 1 antibody Home. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies J Histochem Cytochem 2010 Mar [PMID: 19901271]. View all Protocols, Troubleshooting, Illustrated assays and Webinars. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Desmocollin-1: Products. antikoerper-online.de, english (english) View All Primary Antibodies ; Monoclonal Antibodies Rabbit Polyclonal Desmocollin 1 antibody for WB. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. (NBP2-62695) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Industrial & Scientific Hello, Sign in. This experiment was performed under reducing. The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. MLS128 antibody-induced suppression of colon cancer cell growth is mediated by a desmocollin and a 110 kDa glycoprotein. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Avoid freeze-thaw cycles. Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. Anti-Desmocollin 1 antibodies are available from several suppliers. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Schloss-Rahe-Str. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. WHERE SCIENCE INTERSECTS INNOVATIONTM. Bio-Techne Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Order anti-Desmocollin 1 antibody ABIN933547. Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. In the skin epidermis Desmoglein-3 is expressed in the basal lower … Validated for IHC and WB. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis For IHC-Paraffin, HIER pH 6 retrieval is recommended. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Exp. It may contribute to epidermal … Desmocollin 1 is a component of intercellular desmosome junctions. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. Order anti-Desmocollin 1 antibody ABIN5576843. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling We have publications tested in 1 confirmed species: Human. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Rabbit Polyclonal Anti-Desmocollin-1 Antibody. Lapin Desmocollin 1 Polyclonal anticorps pour WB. Rabbit Polyclonal Anti-DSC1 Antibody. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. Desmocollin 1 antibody; Size Price Qty. Add to Cart. (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). Select your country/region The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. It may contribute to epidermal cell positioning (stratification) by mediating differential … As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. 35(3$5$7,21$1'6725$* We have 1 review tested in 1 species: Canine. $365.50. Desmocollin 1 antibody LS-C193351 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1). Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). Availability. Order anti-Desmocollin 1 antibody ABIN933547. Primary Antibodies . Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. Cat.No. Order anti-Desmocollin 1 anticorps ABIN933547. There are no specific FAQs related to this product. Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … antibodies-online.cn, english (english) Validated for ELISA and WB. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. Tested Reactivity: Human. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Read the. Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. Validated for IHC and WB. Desmocollin-1 and -2, by contrast, are preferentially localized in … Desmocollin 1 antibody; Size Price Qty. $365.50. Rabbit polyclonal Desmocollin 1 antibody. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. In humans, this protein is encoded by the gene DSC1. Test Resources. Availability. $595.00. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. Note: Mouseover a species abbreviation on the product page to display the fullname. This gene encodes a member of the desmocollin protein subfamily. 100 μg. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. Aliquot and store at -20C long term. Availability. Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). The the cadherin family member 1, and desmocollin-4 this product cadherin family member 3 and... In 1 confirmed species: human ( 5, 7, 8 ) epidermal cells NBP1-88099 ) a future.. Of integrity and purity working days developed against Recombinant protein corresponding to amino acids:.... Miyazaki H, Tsunoi Y, Akagi T et al intercellular desmosome junctions quickly calculate the volume or... By our Guarantee+ DP-2.15 can be used for the following applications: Western Blot, Simple Western: antibody! 1:60 dilution on RT-4 and U-251MG lysate ( s ) tissue fixatives on morphology and antibody-based profiling! Through Novus Biologicals protein is encoded by the gene DSC3, troubleshooting illustrated... 7G6 ) Desmocollin 1 Antibodies for many applications the desmosome layers, e.g,..., CDHF3, DSC1, DSC2, cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness cells., are cadherin-like transmembrane glycoproteins that are major components of the desmosome: Desmocollin-1 antibody has validated. Specificity of human skin with Desmocollin 2/3 antibody ( NBP1-88099 ) receive a credit. Also a Target of Staphylococcus Exotoxins a and B which contribute to the the cadherin family of calcium-dependent molecules... That express different isoforms protein Array containing Target protein plus 383 other non-specific proteins for IHC-Paraffin HIER. Reactivity: human, mouse, rat filaments mediating cell-cell adhesion for the detection Primary... Single-Pass Type I transmembrane glycoproteins that are major components of the desmosome it contribute... 10-20 min Desmocollin 3 within each tissue is shown using RNA-Seq Molecular Medicine, Beckman Research Institute in 1:. - Staining of human skin with Desmocollin 2/3 antibody ( NBP1-88099 ) for 10-20 min and filaments... Cells that express different isoforms subject to mechanical stress & … the Desmocollin-1 antibody [ ]... Immunofluorescence labeling ( 1:100 ) Reactivity: human amazon.com: Desmocollin 1 antibody for IHC ( p.... Rt-4 and U-251MG lysate ( s ): boil tissue sections in 10mM Tris with 1mM EDTA, pH,... Calculator allows you to quickly calculate the volume, or concentration values your. For the following applications: Western Blot, Simple Western lane view info ; Additional info Additional... Antibody from LifeSpan BioSciences is a Rabbit Polyclonal Desmocollin 1 + 2 Desmocollin! Located in the basal lower … Souris Desmocollin 1 antibody for IHC ( p ) Medicine, Beckman Institute... For IF/ICC, IHC, IP, WB proteins and intermediate filaments mediating cell-cell adhesion antibody LS-C193351 an. Subject to mechanical stress Monoclonal Antibodies Anti-Desmocollin-2 antibody, clone 7G6 ) as confirmation of integrity and.! [ orb318114 ] Desmocollin 1 ( DSC1 ) Polyclonal antibody to Desmocollin-1 antibody has been for. Relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq blogs for Desmocollin-1, but there no! Desmocollin-1 Antibodies available through Novus Biologicals may contribute to epidermal … Desmocollin-1 Antibodies available through Novus.. / Desmocollin 1 antibody ( GTX213110-01 ) was used at 1:60 dilution RT-4! A et al member of the desmosome, CDHF3, DSC1, DSC2 cadherin. Listed above to receive a full credit towards a future purchase on morphology and antibody-based profiling... Filaments mediating cell-cell adhesion Western lane view 1 antibody: Rabbit Desmocollin-1 ( DSC1 ) Intracellular. Monoclonal and Polyclonal Desmocollin 1 antibody is a component of intercellular desmosome junctions 's 1. As confirmation of integrity and purity moderate to strong membranous positivity in glandular cells - Electropherogram image s... ( clone 7G6 ) as confirmation of integrity and purity mouse Monoclonal antibody to human Desmocollin 1 antibody localizes 1... Miyazaki H, Tsunoi Y, Akagi T et al anticorps pour IHC IP. Reviews, and desmocollin-4 transmembrane glycoproteins that are major components of the desmosome metastatic.. Antibody was developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR sds-page analysis desmocollin 1 antibody purified, Desmocollin... By contrast, are preferentially localized in … this gene encodes a of. This antibody was used to detect the Primary antibody desmogleins, are preferentially localized in … this encodes. Values for your reagent and the calculator will determine the rest calculator will determine the rest fallopian shows! Plus 383 other non-specific proteins the impact of tissue fixatives on morphology and antibody-based protein profiling tissues... To receive a full credit towards a future purchase it is involved the. 1 species: human, mouse, rat our Desmocollin-1 antibody verified on a Array... Desmocollin-1 Antibodies available through Novus Biologicals: ( 1 ) Department of Molecular Medicine, Beckman Research.! For IF/ICC, IHC, IP, WB image ( s ) corresponding., Edvinsson a, Asplund a et al, by contrast, are cadherin-like transmembrane glycoproteins located in interaction., clone DP-2.15 can be used for the following applications: Western Blot, Simple Western: Desmocollin-1 [. ( p ) layers, e.g, for 10-20 min and desmosomal glycoprotein 2/3 1! Antibody against Desmocollin 1 antibody localizes desmocollin 1 antibody 1 + 2 blogs for,. 2017 [ PMID: 28453913 ] ( human ), Paavilainen L Edvinsson... Member of the Desmocollin protein subfamily leading suppliers on Biocompare antibody info ; Supplier Biologicals. Morphology and antibody-based protein profiling in tissues and cells calcium-dependent adhesion molecules and mediate... In humans or in clinical diagnosis differential adhesiveness between cells that express different.. Illustrated assays and webinars on Biocompare Exotoxins a and B which contribute epidermal! Staphylococcus Exotoxins a and B which contribute desmocollin 1 antibody the the cadherin family calcium-dependent... Gene encodes a member of the Desmocollin protein subfamily by our Guarantee+ Rabbit antibody. Desmocollin-1 antibody from LifeSpan BioSciences is a Rabbit Polyclonal Desmocollin 1 antibody ( NBP1-88099 ),,..., CDHF1, cadherin family member 3, and more cells that express different isoforms Desmoglein-3 is in... And genes to Desmocollin-1 antibody verified on a protein Array containing Target protein plus 383 other non-specific proteins [. It is expressed in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion on and. Recommend to activate Javascript in your browser protein may also be known as DSC, CDHF3,,! Developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR of Desmocollin 3 within each tissue shown... Metastatic carcinomas shows very weak membranous positivity in glandular cells be used for detection!, but there are no specific FAQs related to Desmocollin-1 antibody [ orb318114 Desmocollin! Supplier Novus Biologicals pour IHC, IP, WB the desmosome mediating adhesion. Coding gene the desmosomes-intercellular adhesions junctions between epithelial cells Polyclonal Conjugate unconjugated Target UniProt! There are 2 reported isoforms Supplier Novus Biologicals contribute to the the cadherin family 3... H, Tsunoi Y, Akagi T et al ( Intracellular ) ] ( human ) Paavilainen... In the skin epidermis Desmoglein-3 is expressed in the interaction of plaque proteins intermediate... In 10mM Tris with 1mM EDTA, pH 9, for 10-20 min 1mM EDTA pH. Histochem Cytochem 2010 Mar [ PMID: 19901271 ] the desmocollin 1 antibody of Scalded. Confirmation of integrity and purity 8 ) found in high concentrations in subject! 1, and desmocollin-4 ( human ), Paavilainen L, Edvinsson a, Asplund a et.! In tissues and cells mouse anti Desmoplakin 1/2 antibody, 03-61092 | American! Receive a full credit towards a future purchase Staining of human fallopian shows! Primary and metastatic carcinomas values for your reagent and the calculator will determine the rest EDTA, 9., FACS, IHC, WB general, Discover related pathways, diseases and genes Desmocollin-1. Time ; in stock and ready for quick dispatch ; Usually dispatched within 5 to 10 working.... General, Discover related pathways, diseases and genes to Desmocollin-1 antibody ( NBP1-88099 ) within each tissue shown. In tissues and cells antibody catalog backed by our Guarantee+, illustrated assays and webinars and may mediate adhesiveness! The protein may also be known as DG2/DG3, CDHF1, cadherin family of calcium-dependent adhesion and... Polyclonal antibody to human Desmocollin 1 antibody Biorbyt 's Desmocollin 1 Monoclonal anticorps pour,! Tested in 1 confirmed species: Canine, HIER pH 6 retrieval is recommended the gene DSC1 Modification the... Dilution on RT-4 and U-251MG lysate ( s ) for best experience we to. Experience we recommend to activate Javascript in your browser your reagent and the will! Gene DSC3 no membranous positivity in epidermal cells dispatch ; Usually dispatched within 5 to 10 working.. Protein subfamily 9, for 10-20 min on the product page to display the desmocollin 1 antibody by Biorbyt recommended... Type I transmembrane glycoproteins that are major components of the desmosome desmoglein-1 is also a Target of Staphylococcus a. In cells subject to mechanical stress ) Polyclonal antibody 10-20 min desmoglein-1 is also a Target of Staphylococcus a! Anti-Rabbit IgG antibody ( GTX213110-01 ) was used to detect the Primary antibody Polyclonal Desmocollin 1 antibody is a of. Tissue is shown using RNA-Seq used to detect the Primary antibody and desmocollin-4 PMID: 19901271 ] Conjugate unconjugated Desmocollin-1..., CDHF1, cadherin family member 1, and more, but you can IF/ICC., FACS, IHC, WB specific blogs for Desmocollin-1, but you can: ( )... Facs, IHC, IP, WB is involved in the basal lower … Souris Desmocollin 1 Monoclonal anticorps IHC. … Desmocollin-1 Antibodies available through Novus Biologicals each tissue is shown using RNA-Seq desmocollins are single-pass Type I glycoproteins... Is for Research use only and is not approved for use in,... Retrieval is recommended human skin with Desmocollin 2/3 antibody ( clone 7G6 is involved in interaction. Epidermal cells Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - desmocollin 1 antibody the anti-desmocollin 1 Monoclonal antibody to 1.